PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09845.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 378aa    MW: 42383 Da    PI: 6.1533
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09845.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
  mrna09845.1-v1.0-hybrid 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                             678*******************************************97 PP

2Myb_DNA-binding46.21e-1467110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
  mrna09845.1-v1.0-hybrid  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                              788*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.883961IPR017930Myb domain
SuperFamilySSF466897.11E-2912108IPR009057Homeodomain-like
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001674.01E-111761No hitNo description
PROSITE profilePS5129424.35362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2565116IPR009057Homeodomain-like
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PfamPF002499.6E-1467111IPR001005SANT/Myb domain
CDDcd001672.26E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLPGRT DNEIKNFWNS CLKKKLMKQG  120
IDPTTHKPLT DEELLLKDDK TNIVHCSELN NESSSSLPLM PAHEHHQELP MANSSQGPTF  180
LLNESSYFDG TSTGMSTTQG SRAVAAFDST LSYFEFQSSI DPSGYNSDFV TSTQYHPPTT  240
NSIRPSFNYE AIIGYNSMPS LANSDHGSMS GATDFSFSSS NSSTTGFHMN HNNNVVENNA  300
GAFSWDINTE NKLESLFHQF NGPKSEELVM MKPNSSSWEE GQLHHHQHQN SVDFSSYPLT  360
SLSEDLTGAN FDVFQHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299133.10.0PREDICTED: transcription factor MYB86-like
TrEMBLM5WFB81e-167M5WFB8_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-82myb domain protein 86